PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00148.15
Common NameAMTR_s00148p00033940, LOC18995779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 838aa    MW: 92034.3 Da    PI: 6.5504
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00148.15genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.8e-181775357
                                             --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                                 Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                             k  ++t+eq+e+Le++++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  evm_27.model.AmTr_v1.0_scaffold00148.15 17 KYVRYTAEQVEALERVYNECPKPSSLRRQQLIRECpilcNIEPKQIKVWFQNRRCREKQ 75
                                             6789*****************************************************97 PP

2bZIP_119.91.6e-06691121861
                                              HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                   bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                                              rr+R++ ++e  +L++   +L+a Nk L +e+++l+k+va+l  
  evm_27.model.AmTr_v1.0_scaffold00148.15  69 RRCREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVAQLVY 112
                                              9***************************************9965 PP

3START167.87.3e-531643712204
                                              HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGC CS
                                    START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeq 71 
                                              +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++++ve+l d++  
  evm_27.model.AmTr_v1.0_scaffold00148.15 164 IAEETLAEFLSKATGTAVDWVQMPGMKPGPDSIGIVAISHSCSGVAARACGLVSLEPTKVVEILKDRM-S 232
                                              7899****************************************************************.* PP

                                              T-TT-SEEEEEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--. CS
                                    START  72 Wdetlakaetlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe 138
                                              W ++++  ++l v+  g  g+++l++++++a+++l+p Rdf+++Ry+  l++g++v++++S++s +  p 
  evm_27.model.AmTr_v1.0_scaffold00148.15 233 WFRDCRNFDILTVLPLGsgGTIELIYMQTYAPTTLAPaRDFWTLRYTCGLEDGSLVVCERSLTSSNGSPH 302
                                              ******9999999887777**********************************************99998 PP

                                              ...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                                    START 139 ...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                                                  +++vRae+lpSg+li+p+++g+s +++v+h +l++++++++lr+l++s+ + ++k++ a+l++ +
  evm_27.model.AmTr_v1.0_scaffold00148.15 303 gqpVPNFVRAEMLPSGYLIRPCEGGGSIIHIVDHLNLEAWSVPEVLRPLYESSKVLAQKMTIAALRHIR 371
                                              88889***********************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.5971276IPR001356Homeobox domain
SMARTSM003898.0E-151480IPR001356Homeobox domain
CDDcd000863.38E-161777No hitNo description
SuperFamilySSF466892.95E-161779IPR009057Homeodomain-like
PfamPF000465.1E-161775IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-181975IPR009057Homeodomain-like
CDDcd146861.56E-669108No hitNo description
PROSITE profilePS5084825.731154382IPR002913START domain
CDDcd088753.91E-72158374No hitNo description
SMARTSM002343.1E-45163373IPR002913START domain
Gene3DG3DSA:3.30.530.204.3E-22163368IPR023393START-like domain
SuperFamilySSF559612.06E-37163375No hitNo description
PfamPF018521.8E-50164371IPR002913START domain
PfamPF086703.0E-50694836IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MAVAVHKDSS KHMDSSKYVR YTAEQVEALE RVYNECPKPS SLRRQQLIRE CPILCNIEPK  60
QIKVWFQNRR CREKQRKEAS RLQTVNRKLT AMNKLLMEEN DRLQKQVAQL VYENGYMRQQ  120
LQNVSVATTD TSCESVVTSG PQQQNPTPQR PPRDANNPAG LLSIAEETLA EFLSKATGTA  180
VDWVQMPGMK PGPDSIGIVA ISHSCSGVAA RACGLVSLEP TKVVEILKDR MSWFRDCRNF  240
DILTVLPLGS GGTIELIYMQ TYAPTTLAPA RDFWTLRYTC GLEDGSLVVC ERSLTSSNGS  300
PHGQPVPNFV RAEMLPSGYL IRPCEGGGSI IHIVDHLNLE AWSVPEVLRP LYESSKVLAQ  360
KMTIAALRHI RQIAQEMSGE VVFGWGRQPA VLRTFSQRLS RGFNDAVNGF ADDGWSLMSS  420
DGVEDVSVVI NTSPNKHVGM SGGILCAKSS MLLQNVPPAL LIRFLREHRS EWADSNIDAY  480
CAASLKANPF AIPGSGPSRF TGSQIILPLA HTVENEEFVE VIRLEGHGFP QEEAVVCRDL  540
YLLQLCSGVD ENAVGAISQL VFAPIDDSFA DDAPLLPSGF RVIPLDSKTN PQDNTAAAIR  600
TLDLTSSLDI GSATNRASGD GGGPNSCNNL RSVLTIAFQF TFEPHMRDNV VAMARQYVRG  660
VVGSVQRVAM AISPSRLGAQ MGPRLPPGSP EAVTLTRWIT HSYRFHLGVD LLRADCHAGD  720
SVMKLLWHYS DAIMCCSLKA LPVFTFANQA GLDMLETTLV ALQDISLDKI LDEGGRKSLC  780
SDFTKIMQQG YTYLPAGICV SSMGRPVSYD QAIAWKVLTE EEATHCLAFM FINWSFV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846777.10.0PREDICTED: homeobox-leucine zipper protein HOX32 isoform X2
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLW1PK150.0W1PK15_AMBTC; Uncharacterized protein
STRINGVIT_10s0003g04670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6511671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]